PACSIN2 Recombinant monoclonal antibody, PBS Only (Detector)

PACSIN2 Uni-rAb® Recombinant Antibody for IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 84763-2-PBS
Clone No.242193B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, Cytometric bead array, Indirect ELISA

Protein kinase C and casein kinase substrate in neurons protein 2, SdpII, Syndapin-2, Syndapin-II

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84763-2-PBS targets PACSIN2 as part of a matched antibody pair:

MP01542-1: 84763-3-PBS capture and 84763-2-PBS detection (validated in Cytometric bead array)

MP01542-2: 84763-1-PBS capture and 84763-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0809

Product name: Recombinant human PACSIN2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 180-486 aa of BC008037

Sequence: PSLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAIQ

Predict reactive species
Full Name protein kinase C and casein kinase substrate in neurons 2
Calculated Molecular Weight 56 kDa
GenBank Accession NumberBC008037
Gene Symbol PACSIN2
Gene ID (NCBI) 11252
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UNF0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat

Able

正在加载,请稍候...