PACSIN2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84763-4-RR (same clone as 84763-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84763-4-RR (PACSIN2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84763-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 84763-4-RR (same clone as 84763-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 84763-4-RR (PACSIN2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with . This data was developed using the same antibody clone with 84763-4-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 84763-4-RR (same clone as 84763-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using PACSIN2 antibody (84763-4-RR, Clone: 242193H3 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84763-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 84763-4-RR (same clone as 84763-4-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PACSIN2 antibody (84763-4-RR, Clone: 242193H3 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84763-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84763-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84763-4-RR against Human PACSIN2 were performed. The affinity constant is 3.72 nM.

PACSIN2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84763-4-PBS

Clone No.242193H3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

242193H3, Protein kinase C and casein kinase substrate in neurons protein 2, SdpII, Syndapin-2, Syndapin-II

---

Product Information

84763-4-PBS targets PACSIN2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0809

  Product name: Recombinant human PACSIN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-486 aa of BC008037

  Sequence: PSLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAIQ

• Full Name: protein kinase C and casein kinase substrate in neurons 2
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC008037
• Gene Symbol: PACSIN2
• Gene ID (NCBI): 11252
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9UNF0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Peripheral membrane proteins of the Bin/amphiphysin/Rvs (BAR) and Fer-CIP4 homology-BAR (F-BAR) family participate in cellular membrane trafficking (PMID: 19549836). PACSIN2 (also known as syndapin-2) is a member of the protein kinase C and casein kinase substrate in neurons (PACSIN) family, which are membrane-binding proteins characterized by an amino-terminal F-BAR domain. PACSIN2 plays a role in intracellular vesicle-mediated transport. It is involved in the endocytosis of cell-surface receptors like the EGF receptor, contributing to its internalization (PMID: 23129763). PACSIN2 also has a role in caveolae membrane sculpting (PMID: 21610094).