• Featured Product
  • KD/KO Validated

PADI2 Monoclonal antibody, PBS Only (Capture)

PADI2 Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 66386-1-PBS
Clone No.2D8C12

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

EC:3.5.3.15, KIAA0994, PAD H19, PAD2, PAD-H19

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66386-1-PBS targets PADI2 as part of a matched antibody pair:

MP50376-2: 66386-1-PBS capture and 66386-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17612

Product name: Recombinant human PADI2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 118-438 aa of BC009701

Sequence: ISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPL

Predict reactive species
Full Name peptidyl arginine deiminase, type II
Calculated Molecular Weight 665 aa, 75 kDa
Observed Molecular Weight 75 kDa
GenBank Accession NumberBC009701
Gene Symbol PADI2
Gene ID (NCBI) 11240
RRIDAB_2881762
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y2J8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PADI2, also named as KIAA0994, PDI2, PAD-H19 and PAD2(Peptidylarginine deiminase II ), belongs to the protein arginine deiminase family. It catalyzes the deimination of arginine residues of proteins. PADI2 may play a regulatory role in the expression of lactation related genes via histone citrullination during diestrus (PMID:20668670). PADI2 has two isoforms with MW 75 kDa and 49 kDa.

Loading...
||
New chat Able
正在加载,请稍候...