PADI3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PADI3 Polyclonal antibody, PBS Only (33848-1-PBS)

• 

  WB analysis using 33848-1-AP (same clone as 33848-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33848-1-AP (PADI3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33848-1-PBS in a different storage buffer formulation.

PADI3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33848-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

EC:3.5.3.15, PAD3, PDI3, Peptidylarginine deiminase III, Protein-arginine deiminase type III

---

Product Information

33848-1-PBS targets PADI3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35821

  Product name: Recombinant human PADI3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-250 aa of NM_016233.2

  Sequence: MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMFEVYGTPGVDIYISPNMERGRERADTRRWRFDATLEIIVVMNSPSNDLNDSHVQISYHSSHEPLPLAYAVLYLTCVDISLDCDLNCEGRQDRNFVDKRQWVWGPSGYGGILLVNCDRDDPSCDVQDNCDQHVHCLQDLEDMSVMVLRTQGPAALFDDHKLVLHTSSYDAKRAQVFHICGPEDVCEAYRHVLGQDKVSYEVPRLHGDEERFF

• Full Name: peptidyl arginine deiminase, type III
• Calculated Molecular Weight: 75kDa，664aa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: NM_016233.2
• Gene Symbol: PADI3
• Gene ID (NCBI): 51702
• RRID: AB_3743093
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9ULW8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.