PAEP/Glycodelin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human placenta using 85856-2-RR (same clone as 85856-2-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 85856-2-RR (PAEP/Glycodelin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85856-2-PBS in a different storage buffer formulation.

PAEP/Glycodelin Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85856-2-PBS

Clone No.250206H6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Glycodelin, PAEP, GD, GdF, GdS

---

Product Information

85856-2-PBS targets PAEP/Glycodelin in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3037

  Product name: Recombinant Human PAEP/Glycodelin protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 19-180 aa of NM_002571.4

  Sequence: MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

• Full Name: progestagen-associated endometrial protein
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21-25 kDa
• GenBank Accession Number: NM_002571.4
• Gene Symbol: PAEP/Glycodelin
• Gene ID (NCBI): 5047
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09466-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glycodelin (also known as Progestagen Associated Endometrial Protein, PAEP, and Placental Protein 14, PP14) is a secreted human lipocalin-family protein mainly expressed in well-differentiated epithelial cells in human reproductive tissues, like endometrium and seminal vesicles. While different cells produce differentially glycosylated isoforms of Glycodelin: decidualized endometrium-derived glycodelin-A (GdA), seminal vesicle-derived glycodelin-S (GdS), glycodelin-F (isolated from follicular fluid), and glycodelin-C (isolated from cumulus cells). Glycodelin has been involved in cell differentiation and tumor growth.