PAFAH1B2 Polyclonal antibody

• 

  WB analysis of human testis using 14729-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 14729-1-AP (PAFAH1B2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse small intestine using 14729-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 14729-1-AP (PAFAH1B2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 14729-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 14729-1-AP (PAFAH1B2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 14729-1-AP

  IP result of anti-PAFAH1B2 (IP:14729-1-AP, 4ug; Detection:14729-1-AP 1:600) with mouse testis tissue lysate 4000ug.

• Featured Product
• KD/KO Validated

PAFAH1B2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 14729-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, IHC, ELISA

Synonyms

PAF AH 30 kDa subunit, PAF AH subunit beta, PAFAH subunit beta, PAFAH1B2, PAFAHB

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse small intestine tissue
• Positive IP detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

14729-1-AP targets PAFAH1B2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6489

  Product name: Recombinant human PAFAH1B2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-229 aa of BC000398

  Sequence: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA

• Full Name: platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC000398
• Gene Symbol: PAFAH1B2
• Gene ID (NCBI): 5049
• RRID: AB_2159909
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P68402
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC	Cancer Cell Int; Platelet-activating factor acetyl hydrolase IB2 dysregulated cell proliferation in ovarian cancer.; Authors - YingYing He ; KD Validated
mouse	WB	Biol Pharm Bull; A Complex of Type I Platelet-Activating Factor Acetylhydrolase (PAF-AH) Catalytic Subunits Switches from α1/α2 Heterodimer to α2/α2 Homodimer during Adipocyte Differentiation of 3T3-L1 Cells; Authors - Yasuhiro Nakamura