Product Information
11961-1-PBS targets PAGE2 in IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2566 Product name: Recombinant human PAGE2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC054022 Sequence: MSELLRARSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENQAVPAFQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDAQP Predict reactive species |
| Full Name | P antigen family, member 2 (prostate associated) |
| Calculated Molecular Weight | 12 kDa |
| GenBank Accession Number | BC054022 |
| Gene Symbol | PAGE2 |
| Gene ID (NCBI) | 203569 |
| RRID | AB_2877808 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z2X7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



