Filter: AllIHC

IHC staining of human prostate hyperplasia using 11961-1-AP (same clone as 11961-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 11961-1-AP (PAGE2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11961-1-PBS in a different storage buffer formulation.
IHC staining of human prostate hyperplasia using 11961-1-AP (same clone as 11961-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 11961-1-AP (PAGE2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11961-1-PBS in a different storage buffer formulation.

PAGE2 Polyclonal antibody, PBS Only

PAGE2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 11961-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

11961-1-PBS targets PAGE2 in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2566 Product name: Recombinant human PAGE2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC054022 Sequence: MSELLRARSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENQAVPAFQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDAQP Predict reactive species
Full Name	P antigen family, member 2 (prostate associated)
Calculated Molecular Weight	12 kDa
GenBank Accession Number	BC054022
Gene Symbol	PAGE2
Gene ID (NCBI)	203569
RRID	AB_2877808
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q7Z2X7
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™