Filter: AllIHC

IHC staining of human breast cancer using 24598-1-AP (same clone as 24598-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24598-1-AP (PAGE3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 24598-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 24598-1-AP (same clone as 24598-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24598-1-AP (PAGE3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 24598-1-PBS in a different storage buffer formulation.

PAGE3 Polyclonal antibody, PBS Only

Name: PAGE3 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 24598-1-PBS

PAGE3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 24598-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

24598-1-PBS targets PAGE3 in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag20171 Product name: Recombinant human PAGE3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC140001 Sequence: MSGHQRTRSRSRERRDDQDSNHPVGAVVAQELPSDDQLQQEEPPIESQDYTPGQERDEGALDFQVLGLAAYLWELTRSKTGGERGDGPNVKGEFLPNLEPVKIPEAGEGQPSV Predict reactive species
Full Name	P antigen family, member 3 (prostate associated)
Calculated Molecular Weight	113 aa, 12 kDa
GenBank Accession Number	BC140001
Gene Symbol	PAGE3
Gene ID (NCBI)	139793
RRID	AB_2879631
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q5JUK9
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™