PAGE4 Polyclonal antibody

• 

PAGE4 Polyclonal Antibody for ELISA

Cat No. 15900-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

G antigen family C member 1, GAGE 9, GAGEC1, JM 27, JM27, PAGE 1, PAGE 4, PAGE4

---

Product Information

15900-1-AP targets PAGE4 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8727

  Product name: Recombinant human PAGE4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC010897

  Sequence: MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP

• Full Name: P antigen family, member 4 (prostate associated)
• Calculated Molecular Weight: 102 aa, 11 kDa
• GenBank Accession Number: BC010897
• Gene Symbol: PAGE4
• Gene ID (NCBI): 9506
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60829
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.