PAK7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PAK7 Polyclonal antibody, PBS Only (32085-1-PBS)

• 

  WB analysis using 32085-1-AP (same clone as 32085-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32085-1-AP (PAK7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32085-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 32085-1-AP (same clone as 32085-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 32085-1-AP (PAK7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32085-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 32085-1-AP (same clone as 32085-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 32085-1-AP (PAK7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32085-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 32085-1-AP (same clone as 32085-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using PAK7 antibody (32085-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 32085-1-PBS in a different storage buffer formulation.

PAK7 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 32085-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

PAK4/6/7, EC:2.7.11.1, KIAA1264, p21-activated kinase 5, p21-activated kinase 7

---

Product Information

32085-1-PBS targets PAK7 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29190

  Product name: Recombinant human PAK7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-360 aa of BC024179

  Sequence: AYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS

• Full Name: p21 protein (Cdc42/Rac)-activated kinase 7
• Calculated Molecular Weight: 719 aa, 81 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC024179
• Gene Symbol: PAK7
• Gene ID (NCBI): 57144
• RRID: AB_3670187
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P286
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PAK7, also known as PAK5, is a newly found but scarcely researched type II PAKs (PAK4, 5, 6). PAK7 was originally found in the brain, which promotes filopodia formation in nerve cells. Recently, studies have found that the expression level of PAK7 significantly increased in colorectal cancer, ovarian cancer, gastric cancer, neuroglioma, hepatocellular carcinoma, pancreatic cancer, osteosarcoma, and breast cancer. PAK7 plays an important role in tumorigenesis, invasion, and metastasis, mainly related to its mechanism of regulating cytoskeleton, inhibiting apoptosis, and promoting proliferation. The calculated molecular weight of PAK7 is 80 kDa (PMID: 29805709, PMID: 34165002).