PALB2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PALB2 Polyclonal antibody, PBS Only (14340-1-PBS)

• 

  WB analysis using 14340-1-AP (same clone as 14340-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14340-1-AP (PALB2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14340-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 14340-1-AP (same clone as 14340-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14340-1-AP (PALB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14340-1-PBS in a different storage buffer formulation.

PALB2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14340-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

14340-1-PBS targets PALB2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5654

  Product name: Recombinant human PALB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 841-1186 aa of BC044254

  Sequence: TAELPASDSINPGNLQLVSELKNPSGSCSVDVSAMFWERAGCKEPCIITACEDVVSLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCSSDDESEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGGKENQFLMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLLFIVLSHPCAKESESLRSPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHCAAAILTSGTIAIWDLLLGQCTALLPPVSDQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS

• Full Name: partner and localizer of BRCA2
• Calculated Molecular Weight: 131 kDa
• Observed Molecular Weight: 130 kDa; 80-90 kDa; 250-260 kDa
• GenBank Accession Number: BC044254
• Gene Symbol: PALB2
• Gene ID (NCBI): 79728
• RRID: AB_2158774
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86YC2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PALB2 can interact with BRCA1 and BRCA2 and form the BRCA1-PALB2-BRCA2 complex which is critical for homologous recombination and DNA damage response. PALB2 is an essential partner of BRCA2 that promotes the localization and stability of BRCA2. The predicted MW of PALB2 is approximately 130 kDa, while the truncated PALB2 protein arround 80-90 kDa can also be detected in SDS-PAGE similar to papers. (PubMed:16793542, 24141787, 24153426). There's the dimer form with MW 250-260 kDa (refer to PMID: 30289697).