PANK1 Polyclonal antibody

• 

  WB analysis of Raji using 11768-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 11768-1-AP (PANK1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11768-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11768-1-AP (PANK1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SW 1990 using 11768-1-AP

  SW 1990 cells were subjected to SDS PAGE followed by western blot with 11768-1-AP (PANK1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 11768-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11768-1-AP (PANK1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 11768-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 11768-1-AP (PANK1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

PANK1 Polyclonal Antibody for WB, ELISA

Cat No. 11768-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

hPanK, hPanK1, PANK, PANK1, PANK1a, PANK1b, pantothenate kinase 1, Pantothenic acid kinase 1

---

Tested Applications

• Positive WB detected in: Raji cells, SW 1990 cells, HeLa cells, human heart tissue, MCF-7 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below

Product Information

11768-1-AP targets PANK1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2324

  Product name: Recombinant human PANK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 462-598 aa of BC026296

  Sequence: MAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK

• Full Name: pantothenate kinase 1
• Calculated Molecular Weight: 598 aa, 64 kDa
• Observed Molecular Weight: 61-64 kDa, 40-45 kDa
• GenBank Accession Number: BC026296
• Gene Symbol: PANK1
• Gene ID (NCBI): 53354
• RRID: AB_2158913
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TE04
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PANK1(Pantothenate kinase 1) is also named as PANk and belongs to the type II pantothenate kinase family. The PANK1 protein, which catalyzes the rate-limiting step of coenzyme A biosynthesis, is also upregulated by p53(PMID:20833636). It also catalyzes the cytosolic phosphorylation of pantothenate (vitamin B5) and derivatives. This protein has 4 isoforms produced by alternative splicing with the molecular weight of 64 kDa, 42 kDa, 36kDa and 45 kDa,respectively.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Cell Mol Med; PMID: 32048816; Authors - Lu Yang ; KD Validated
human	WB	Int J Biol Sci; Pantothenate Kinase 1 Inhibits the Progression of Hepatocellular Carcinoma by Negatively Regulating Wnt/β-catenin Signaling.; Authors - Yuyuan Zi ; KD Validated
human	WB	Mol Med Rep; Dioscin inhibits SCC15 cell proliferation via the RASSF1A/MST2/YAP axis.; Authors - Hui Tian