PAOX Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PAOX Polyclonal antibody, PBS Only (18972-1-PBS)

• 

  WB analysis using 18972-1-AP (same clone as 18972-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 18972-1-AP (PAOX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18972-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18972-1-AP (same clone as 18972-1-PBS)

  Rat pancreas tissue were subjected to SDS PAGE followed by western blot with 18972-1-AP (PAOX antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18972-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human stomach using 18972-1-AP (same clone as 18972-1-PBS)

  human stomach tissue were subjected to SDS PAGE followed by western blot with 18972-1-AP (PAOX antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18972-1-PBS in a different storage buffer formulation.

PAOX Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18972-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

EC:1.5.3.13, PAO, Peroxisomal N(1)-acetyl-spermine/spermidine oxidase, UNQ1923/PRO4398

---

Product Information

18972-1-PBS targets PAOX in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5777

  Product name: Recombinant human PAOX protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 31-364 aa of BC032778

  Sequence: RLCGHSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGASVSLQLVAEMATLFYGLIDQTREFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLKLAVLNSFFNLECCVSGTHSMDLVALAPFGEYTVLPGLDCTFSKGYQGLTNCMMAALPEDTVVFEKPVKTIHWNGSFQEAAFPGETFPVSVECEDGDRFPAHHVIVTVPLGFLREHLDTFFDPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQLVWEDTSPLEDAAPELQDAWFRKL

• Full Name: polyamine oxidase (exo-N4-amino)
• Calculated Molecular Weight: 511 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC032778
• Gene Symbol: PAOX
• Gene ID (NCBI): 196743
• RRID: AB_2159196
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6QHF9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PAOX, also known as PAO, belongs to the flavin monoamine oxidase family. PAOX is a FAD-dependent amine oxidase, which is constitutively expressed in nearly all tissues of the vertebrate organism. PAOX catalyzes the oxidation of N1-acetylspermine to spermidine and thus involved in the polyamine back-conversion. PAOX can also oxidize N1-acetylspermidine to putrescine. PAOX has 4 isoforms with the molecular weights of 7, 35, 52 and 56 kDa.