PAPPA Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PAPPA Polyclonal antibody, PBS Only (18095-1-PBS)

• 

  WB analysis using 18095-1-AP (same clone as 18095-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 18095-1-AP (PAPPA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18095-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 18095-1-AP (same clone as 18095-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 18095-1-AP (PAPPA antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18095-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 18095-1-AP (same clone as 18095-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 18095-1-AP (PAPPA antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18095-1-PBS in a different storage buffer formulation.

PAPPA Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 18095-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

18095-1-PBS targets PAPPA in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11863

  Product name: Recombinant human PAPPA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1279-1627 aa of BC078657

  Sequence: ACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLQGYSHG

• Full Name: pregnancy-associated plasma protein A, pappalysin 1
• Calculated Molecular Weight: 1627 aa, 181 kDa
• Observed Molecular Weight: 180-220 kDa
• GenBank Accession Number: BC078657
• Gene Symbol: PAPPA
• Gene ID (NCBI): 5069
• RRID: AB_3085554
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13219
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Pregnancy-associated plasma protein A (PAPPA) is a metalloproteinase secreted by human placenta, and it can interact with IGF-binding proteins (IGFBPs) to regulate the proteolysis and the bioavailability of insulin-like growth factor (IGF). Circulating PAPPA represents a consolidated biomarker in combined first-trimester screening tests, allowing an early prenatal diagnosis of chromosomal abnormalities, preeclampsia, and intrauterine growth restriction risk. PAPPA is highly expressed in placenta and pregnancy serum (PMID: 34974815, 34974815).