PAPSS2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PAPSS2 Polyclonal antibody, PBS Only (15978-1-PBS)

• 

  WB analysis of HepG2 using 15978-1-AP (same clone as 15978-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15978-1-AP (PAPSS2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15978-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 15978-1-AP (same clone as 15978-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 15978-1-AP (PAPSS2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15978-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 15978-1-AP (same clone as 15978-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15978-1-AP (PAPSS2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15978-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 15978-1-AP (same clone as 15978-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15978-1-AP (PAPSS2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15978-1-PBS in a different storage buffer formulation.

PAPSS2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15978-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

3'-phosphoadenosine-5'-phosphosulfate synthase, Adenosine-5'-phosphosulfate 3'-phosphotransferase, Adenylylsulfate 3'-phosphotransferase, Adenylyl-sulfate kinase, ATPSK2

---

Product Information

15978-1-PBS targets PAPSS2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8766

  Product name: Recombinant human PAPSS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-333 aa of BC009894

  Sequence: MSGIKKQKTENQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQVMHFDTLLDDGVINMSIPIVLPVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEF

• Full Name: 3'-phosphoadenosine 5'-phosphosulfate synthase 2
• Calculated Molecular Weight: 614 aa, 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC009894
• Gene Symbol: PAPSS2
• Gene ID (NCBI): 9060
• RRID: AB_2159498
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95340
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.