PAQR4 Polyclonal antibody

• 

  WB analysis of HeLa using 13401-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13401-1-AP (PAQR4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 13401-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 13401-1-AP (PAQR4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

PAQR4 Polyclonal Antibody for WB, ELISA

Cat No. 13401-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

PAQR4

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

13401-1-AP targets PAQR4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4241

  Product name: Recombinant human PAQR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 133-273 aa of BC033703

  Sequence: PIIHCTLACRPWLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD

• Full Name: progestin and adipoQ receptor family member IV
• Calculated Molecular Weight: 273 aa, 29 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC033703
• Gene Symbol: PAQR4
• Gene ID (NCBI): 124222
• RRID: AB_10642958
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N4S7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Theranostics; PAQR4 promotes chemoresistance in non-small cell lung cancer through inhibiting Nrf2 protein degradation.; Authors - Peifang Xu ; KD Validated
human	WB	Front Cell Dev Biol; Circular RNA CircNOLC1, Upregulated by NF-KappaB, Promotes the Progression of Prostate Cancer via miR-647/PAQR4 Axis.; Authors - Wenbin Chen
human	WB	Acta Biochim Biophys Sin (Shanghai); PAQR4 promotes the development of hepatocellular carcinoma by activating PI3K/AKT pathway.; Authors - Gang Zhao ; KD Validated
		Adv Biol (Weinh); Suspended Collagen Hydrogels to Replicate Human Colonic Epithelial Cell Interactions with Immune Cells.; Authors - Samuel S Hinman
human	WB	Cancer Gene Ther; VEZF1, destabilized by STUB1, affects cellular growth and metastasis of hepatocellular carcinoma by transcriptionally regulating PAQR4; Authors - Xiaobao Shi
human	WB,IHC	Exp Hematol Oncol; ALKBH5 prevents hepatocellular carcinoma progression by post-transcriptional inhibition of PAQR4 in an m6A dependent manner; Authors - Weijian Wang