PAQR4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PAQR4 Polyclonal antibody (13401-1-AP)

PAQR4 Polyclonal Antibody for WB, ELISA

Cat No. 13401-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

PAQR4

• 

  WB analysis of HeLa using 13401-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13401-1-AP (PAQR4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 13401-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 13401-1-AP (PAQR4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PAQR4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13401-1-AP targets PAQR4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4241

  Product name: Recombinant human PAQR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 133-273 aa of BC033703

  Sequence: PIIHCTLACRPWLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD

• Full Name: progestin and adipoQ receptor family member IV
• Calculated Molecular Weight: 273 aa, 29 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC033703
• Gene Symbol: PAQR4
• Gene ID (NCBI): 124222
• RRID: AB_10642958
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N4S7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PAQR4 antibody (Cat# 13401-1-AP) has 7 total citations. These appear in journals including Experimental Hematology & Oncology, Theranostics, Cancer Gene Therapy, Frontiers in Cell and Developmental Biology, Acta Biochimica et Biophysica Sinica, Journal of Cellular Physiology, and Advanced Biology. Research fields span hepatocellular carcinoma, non-small cell lung cancer, prostate cancer, cell proliferation and apoptosis regulation, and colonic epithelial–immune cell interactions. Applications include WB, IHC, and IF in human and mouse samples.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Exp Hematol Oncol; ALKBH5 prevents hepatocellular carcinoma progression by post-transcriptional inhibition of PAQR4 in an m6A dependent manner; Authors - Weijian Wang
mouse	WB,IF	Theranostics; PAQR4 promotes chemoresistance in non-small cell lung cancer through inhibiting Nrf2 protein degradation.; Authors - Peifang Xu ; KD Validated
human	WB	Cancer Gene Ther; VEZF1, destabilized by STUB1, affects cellular growth and metastasis of hepatocellular carcinoma by transcriptionally regulating PAQR4; Authors - Xiaobao Shi
human	WB	Front Cell Dev Biol; Circular RNA CircNOLC1, Upregulated by NF-KappaB, Promotes the Progression of Prostate Cancer via miR-647/PAQR4 Axis.; Authors - Wenbin Chen
human	WB	Acta Biochim Biophys Sin (Shanghai); PAQR4 promotes the development of hepatocellular carcinoma by activating PI3K/AKT pathway.; Authors - Gang Zhao ; KD Validated
human	WB	J Cell Physiol; LINC00162 regulates cell proliferation and apoptosis by sponging PAQR4-targeting miR-485-5p; Authors - Woo Joo Lee ; KD Validated