Tested Applications
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-14060 targets PARK2/Parkin in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5092 Product name: Recombinant human Parkin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 81-387 aa of BC022014 Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK Predict reactive species |
| Full Name | Parkinson disease (autosomal recessive, juvenile) 2, parkin |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 42-52 kDa |
| GenBank Accession Number | BC022014 |
| Gene Symbol | Parkin |
| Gene ID (NCBI) | 5071 |
| RRID | AB_2934702 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60260 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Parkin, a RING-type E3 ubiquitin-protein ligase, is involved in the ubiquitination pathway and contributes to protection from neurotoxicity induced by unfolded protein stresses. Its ubiquitin-protein ligase activity promotes the degradation of a variety of proteins including itself. Mutations in Parkin are implicated in the pathogenesis of autosomal recessive familial Parkinson's disease. It has 8 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 PARK2/Parkin antibody CL594-14060 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

