PARL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PARL Polyclonal antibody (26679-1-AP)

PARL Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26679-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, CoIP, ELISA

Synonyms

MAMP, PACT, PARL, Pbeta, PRO2207, PSARL, PSARL1, PSENIP2, RHBDS1

• 

  WB analysis of 3T3-L1 using 26679-1-AP

  3T3-L1 cells were subjected to SDS PAGE followed by western blot with 26679-1-AP (PARL Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 26679-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 26679-1-AP (PARL Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Neuro-2a using 26679-1-AP

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 26679-1-AP (PARL Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 26679-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 26679-1-AP (PARL Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 26679-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26679-1-AP (PARL Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 26679-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 26679-1-AP (PARL Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 26679-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 26679-1-AP (PARL Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 26679-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26679-1-AP (PARL Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 26679-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26679-1-AP (PARL Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PARL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: 3T3-L1 cells, HEK-293 cells, HeLa cells, Neuro-2a cells
• Positive IHC detected in: human prostate cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26679-1-AP targets PARL in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24789

  Product name: Recombinant human PARL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 56-167 aa of BC014058

  Sequence: APRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQR

• Full Name: presenilin associated, rhomboid-like
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 36-42 kDa
• GenBank Accession Number: BC014058
• Gene Symbol: PARL
• Gene ID (NCBI): 55486
• RRID: AB_2880599
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H300
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PARL (Presenilin associated rhomboid like), is a member of the rhomboid family of intramembrane serine proteases that is localized to the inner mitochondrial membrane. PARL has 2 isoforms produced by alternative splicing with the molecular mass of 42 kDa and 37 kDa. PARL regulates mitochondrial remodeling and apoptosis through regulated substrate proteolysis. Proteolytic processing of PARL may result in the release of a small peptide, P-beta, which may transit to the nucleus. The self-regulated cleavage of PARL at positions 52-53 (α-site) and 77--78 (β-site) produce two cleaved forms of PARL named MAMP and PACT with the molecular mass of 36 kDa and 33 kDa respectively (PMID: 14732705, 28178523).

Publications

What published studies show

The PARL Polyclonal antibody (Cat# 26679-1-AP) has 14 citations published in journals including Nature Cell Biology, Nature Communications, Molecular Cell, PNAS, EMBO Journal, Redox Biology, Free Radical Biology and Medicine, Cell Reports, Journal of Cell Biology, Cells, International Journal of Molecular Sciences, Frontiers in Pharmacology, and Journal of Biological Chemistry. Research fields span mitophagy, mitochondrial quality control, oxidative phosphorylation, cancer, muscle wasting, heart regeneration, and inflammatory bowel disease.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Nat Cell Biol; Small heat shock proteins operate as molecular chaperones in the mitochondrial intermembrane space; Authors - Elias Adriaenssens
human	WB	Nat Commun; ROS-induced cytosolic release of mitochondrial PGAM5 promotes colorectal cancer progression by interacting with MST3; Authors - Shiyang Wang
mouse	CoIP	Redox Biol; Targeting Dio3 to enhance mitophagy and ameliorate skeletal muscle wasting in sepsis; Authors - Gang Wang
human	WB	Mol Cell; Identification of TMEM126A as OXA1L-interacting protein reveals cotranslational quality control in mitochondria; Authors - Sabine Poerschke
human, mouse	WB,IP,CoIP	Proc Natl Acad Sci U S A; Mitochondrial ROS triggers mitophagy through activating the DNA damage response signaling pathway.; Authors - Qi-Qiang Guo
human, mouse	WB	EMBO J; Stress-induced OMA1-mediated cleavage of AIFM1 suppresses cell growth by controlling mitochondrial OXPHOS activity.; Authors - Mitsuhiro Nishigori