PARN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PARN Polyclonal antibody (13799-1-AP)

• KD/KO Validated

PARN Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13799-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

DAN, EC:3.1.13.4, Poly(A)-specific ribonuclease PARN, Polyadenylate-specific ribonuclease

• 

  WB analysis using 13799-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13799-1-AP (PARN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 13799-1-AP

  WB result of PARN antibody (13799-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-PARN transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 13799-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 13799-1-AP (PARN antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 13799-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 13799-1-AP (PARN antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HepG2 cells, Jurkat cell, MDA-MB-453s cells
• Positive IHC detected in: human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13799-1-AP targets PARN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4774

  Product name: Recombinant human PARN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-347 aa of BC050029

  Sequence: MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELE

• Full Name: poly(A)-specific ribonuclease (deadenylation nuclease)
• Calculated Molecular Weight: 639 aa, 73 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC050029
• Gene Symbol: PARN
• Gene ID (NCBI): 5073
• RRID: AB_2160430
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95453
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Poly(A)-specific ribonuclease (PARN) is a deadenylase enzyme that is present in mammalian cells. As a deadenylase, PARN interacts with the cap and the poly(A) tail of mRNA to control the length of the poly(A) tail and regulate gene expression. Therefore, it plays a role in mRNA degradation in the nucleus and cytoplasm.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Hum Mol Genet; CGG repeats in RNA modulate expression of TDP-43 in mouse and fly models of fragile X tremor ataxia syndrome.; Authors - Jocelyn N Galloway
human	IF	Neurobiol Dis; Distinct Poly(A) nucleases have differential impact on sut-2 dependent tauopathy phenotypes.; Authors - Rebecca L Kow
mouse	WB	Cell Rep; YTHDF2/3 Are Required for Somatic Reprogramming through Different RNA Deadenylation Pathways.; Authors - Jiadong Liu
human	WB	Cell Rep; The long isoform of ZAP coordinates multiple enzymes to mediate complete decay of target transcripts.; Authors - Clément R. Bouton
human	WB	Nucleic Acids Res; Molecular mechanism of human ISG20L2 for the ITS1 cleavage in the processing of 18S precursor ribosomal RNA; Authors - Yinliang Ma