PARP14 Recombinant monoclonal antibody

• 

  WB analysis using 84039-6-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84039-6-RR (PARP14 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse colon using 84039-6-RR

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84039-6-RR (PARP14 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 84039-6-RR

  Biolayer interferometry (BLl) kinetic assays of 84039-6-RR against Human PARP14 were performed. The affinity constant is 0.685 nM.

PARP14 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84039-6-RR

Clone No.241078C11

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

PARP 14, KIAA1268, BAL2, 241078C11

---

Tested Applications

• Positive WB detected in: A549 cells, U2OS cells
• Positive IHC detected in: mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84039-6-RR targets PARP14 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35007

  Product name: Recombinant human PARP14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1501-1640 aa of NM_017554

  Sequence: SRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTC

• Full Name: poly (ADP-ribose) polymerase family, member 14
• Calculated Molecular Weight: 203kd
• Observed Molecular Weight: 200 kDa
• GenBank Accession Number: NM_017554
• Gene Symbol: PARP14
• Gene ID (NCBI): 54625
• RRID: AB_3671606
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q460N5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PARP14 (poly (ADP-ribose) polymerase family, member 14) is a PARP family member that has roles in DNA repair, B cell regulation, and focal adhesion (PMID: 25753673). The largest of all the human PARPs is PARP14. PARP14 has been reported to regulate several different pathways involved in immunity, inflammation, and genome stability (PMID: 37703374).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Lisa (Verified Customer) (07-24-2025)

Produces clear signals with minimal background and can be reused multiple times without performance loss. Works very well.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000