PARS2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PARS2 Polyclonal antibody (15864-1-AP)

PARS2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 15864-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

EC:6.1.1.15, MT PRORS, Probable proline--tRNA ligase, mitochondrial, Proline tRNA ligase, Prolyl-tRNA synthetase

• 

  WB analysis using 15864-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15864-1-AP (PARS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 15864-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using PARS2 antibody (15864-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse heart tissue, mouse spleen tissue, rat heart tissue
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15864-1-AP targets PARS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8413

  Product name: Recombinant human PARS2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 126-475 aa of BC007956

  Sequence: ELWQATNRWDLMGKELLRLRDRHGKEYCLGPTHEEAITALIASQKKLSYKQLPFLLYQVTRKFRDEPRPRFGLLRGREFYMKDMYTFDSSPEAAQQTYSLVCDAYCSLFNKLGLPFVKVQADVGTIGGTVSHEFQLPVDIGEDRLAICPRCSFSANMETLDLSQMNCPACQGPLTKTKGIEVGHTFYLGTKYSSIFNAQFTNVCGKPTLAEMGCYGLGVTRILAAAIEVLSTEDCVRWPSLLAPYQACLIPPKKGSKEQAASELIGQLYDHITEAVPQLHGEVLLDDRTHLTIGNRLKDANKFGYPFVIIAGKRALEDPAHFEVWCQNTGEVAFLTKDGVMDLLTPVQTV

• Full Name: prolyl-tRNA synthetase 2, mitochondrial (putative)
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC007956
• Gene Symbol: PARS2
• Gene ID (NCBI): 25973
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L3T8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Prolyl-tRNA synthetase 2, mitochondrial (PARS2) is a nuclear-encoded mitochondrial aminoacyl-tRNA synthetase (mt-aaRS) responsible for catalyzing the attachment of proline to mitochondrial tRNA^Pro, an essential step in mitochondrial protein translation. Following cytoplasmic synthesis, PARS2 is imported into the mitochondrial matrix, where it ensures the accurate synthesis of the 13 oxidative phosphorylation (OXPHOS) proteins encoded by mitochondrial DNA. By maintaining the fidelity of mitochondrial translation, PARS2 is indispensable for mitochondrial respiratory chain function, ATP production, and cellular energy metabolism.