PARVG Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PARVG Polyclonal antibody, PBS Only (13284-1-PBS)

• 

  WB analysis of HL-60 using 13284-1-AP (same clone as 13284-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13284-1-AP (PARVG antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13284-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 13284-1-AP (same clone as 13284-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 13284-1-AP (PARVG antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13284-1-PBS in a different storage buffer formulation.

PARVG Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13284-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

parvin, gamma, Gamma-parvin, Gamma parvin

---

Product Information

13284-1-PBS targets PARVG in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4109

  Product name: Recombinant human PARVG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-331 aa of BC034406

  Sequence: MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN

• Full Name: parvin, gamma
• Calculated Molecular Weight: 331 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC034406
• Gene Symbol: PARVG
• Gene ID (NCBI): 64098
• RRID: AB_2159068
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBI0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.