PAX8 Monoclonal antibody, PBS Only (Capture)

PAX8 Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 60144-1-PBS
Clone No.1C5A11

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

PAX-8, paired box 8, Paired box protein Pax 8, Paired box protein Pax-8, PAX 8

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60144-1-PBS targets PAX8 as part of a matched antibody pair:

MP50408-4: 60144-1-PBS capture and 68979-2-PBS detection (validated in Cytometric bead array)

MP50408-5: 60144-1-PBS capture and 68979-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0306

Product name: Recombinant human PAX8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-212 aa of BC001060

Sequence: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS

Predict reactive species
Full Name paired box 8
Calculated Molecular Weight 48 kDa
GenBank Accession NumberBC001060
Gene Symbol PAX8
Gene ID (NCBI) 7849
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ06710
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PAX8 is a member of the paired box (PAX) family of transcription factors, typically containing a paired box domain and a paired-type homeodomain. It is expressed during organogenesis of the thyroid gland, kidney and Mullerian system. It is thought to regulate the expression of Wilms tumor suppressor (WT1) gene and mutations in PAX8 have been associated with Wilms tumor cells, thyroid and ovarian carcinomas. PAX8 is a useful marker in distinguishing ovarian carcinomas from mammary carcinomas (PMID: 18724243). PAX8 is expressed in a high percentage of ovarian serous, endometrioid, and clear cell carcinomas, but only rarely in primary ovarian mucinous adenocarcinomas.

PAX8 has 5 isoforms with calculated MW 31kd, 34kd, 41kd, 43kd and 48kd. And there is a 60kd band corresponding to the electrophoretic mobility of PAX8 (PMID:15650356).

Loading...
||
New chat

Able

正在加载,请稍候...