Product Information
68979-1-PBS targets PAX8 as part of a matched antibody pair:
MP50408-3: 60144-2-PBS capture and 68979-1-PBS detection (validated in Cytometric bead array)
MP50408-5: 60144-1-PBS capture and 68979-1-PBS detection (validated in Cytometric bead array)
MP50408-6: 60144-3-PBS capture and 68979-1-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16019 Product name: Recombinant human PAX8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 135-212 aa of BC001060 Sequence: KVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS Predict reactive species |
| Full Name | paired box 8 |
| Calculated Molecular Weight | 450 aa, 48 kDa |
| GenBank Accession Number | BC001060 |
| Gene Symbol | PAX8 |
| Gene ID (NCBI) | 7849 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q06710 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
