PAX8 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PAX8 Recombinant monoclonal antibody, PBS Only (81032-1-PBS)

PAX8 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 81032-1-PBS

Clone No.6C24

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

PAX-8, paired box 8, Paired box protein Pax 8, Paired box protein Pax-8, PAX 8

• 

  IHC staining of human ovary tumor using 81032-1-RR (same clone as 81032-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 81032-1-RR (PAX8 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81032-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 81032-1-RR (same clone as 81032-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 81032-1-RR (PAX8 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81032-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 81032-1-RR (same clone as 81032-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 81032-1-RR (PAX8 antibody) at dilution of 1:2800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81032-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 81032-1-RR (same clone as 81032-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 81032-1-RR (PAX8 antibody) at dilution of 1:2800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81032-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SKOV-3 using 81032-1-RR (same clone as 81032-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SKOV-3 cells using PAX8 antibody (81032-1-RR, Clone: 6C24 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 81032-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 81032-1-RR

  Biolayer interferometry (BLI) kinetic assays of 81032-1-RR against Human PAX8 were performed. The affinity constant is 1.07 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

81032-1-PBS targets PAX8 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0306

  Product name: Recombinant human PAX8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-212 aa of BC001060

  Sequence: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS

• Full Name: paired box 8
• Calculated Molecular Weight: 48 kDa
• GenBank Accession Number: BC001060
• Gene Symbol: PAX8
• Gene ID (NCBI): 7849
• RRID: AB_3743364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q06710
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PAX8 is a member of the paired box (PAX) family of transcription factors, typically containing a paired box domain and a paired-type homeodomain. It is expressed during organogenesis of the thyroid gland, kidney and Mullerian system. It is thought to regulate the expression of Wilms tumor suppressor (WT1) gene and mutations in PAX8 have been associated with Wilms tumor cells, thyroid and ovarian carcinomas. PAX8 is a useful marker in distinguishing ovarian carcinomas from mammary carcinomas (PMID: 18724243). PAX8 is expressed in a high percentage of ovarian serous, endometrioid, and clear cell carcinomas, but only rarely in primary ovarian mucinous adenocarcinoma.