• Featured Product
  • KD/KO Validated

CoraLite®555-conjugated PBK Polyclonal antibody

PBK Polyclonal Antibody for
Cat No. CL555-16110

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

Cancer/testis antigen 84, CT84, FLJ14385, MAPKK like protein kinase, Nori 3, PBK, PDZ binding kinase, SPK, TOPK

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®555
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL555-16110 targets PBK in applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9033

Product name: Recombinant human SPK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-322 aa of BC015191

Sequence: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV

Predict reactive species
Full Name PDZ binding kinase
Calculated Molecular Weight 322 aa, 36 kDa
Observed Molecular Weight 36-40 kDa
GenBank Accession NumberBC015191
Gene Symbol PBK
Gene ID (NCBI) 55872
RRIDAB_2919630
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96KB5
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PBK(PDZ-binding kinase) is also named as TOPK, CT84, Nori-3, SPK and belongs to the MAP kinase kinase subfamily. PBK may have a role in the regulation of cellular proliferation and progression of the cell cycle. It has a characteristic cdc2ycyclin B phosphorylation site(SyT-P-X-KyR) at its N terminus,which is conserved across species, and it is phosphorylated in a cell cycle-dependent manner at mitosis, and that this phosphorylation is required for its activation(PMID:10779557).

Loading...
||
New chat Able
正在加载,请稍候...