PBRM1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83677-2-RR (same clone as 83677-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83677-2-RR (PBRM1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83677-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 83677-2-RR (same clone as 83677-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PBRM1 antibody (83677-2-RR, Clone: 240655H5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83677-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83677-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 83677-2-PBS against Human PBRM1 was performed. The affinity constant is 3.68 nM.

• 

  Affinity and Kinetic Characterization of 83677-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83677-2-RR against Human PBRM1 were performed. The affinity constant is 2.34 nM.

PBRM1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 83677-2-PBS

Clone No.240655H5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

240655H5, BAF180, BRG1-associated factor 180, hPB1, PB1

---

Product Information

83677-2-PBS targets PBRM1 in WB, IF/ICC, Cytometric bead array, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33623

  Product name: Recombinant human PBRM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-306 aa of BC015323

  Sequence: MGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAEYEGMMGGYPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPYGQQVGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLMLRDTLNIRQAYNLENV*

• Full Name: polybromo 1
• Calculated Molecular Weight: 180 kDa
• Observed Molecular Weight: 180-195 kDa
• GenBank Accession Number: BC015323
• Gene Symbol: PBRM1
• Gene ID (NCBI): 55193
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86U86
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PBRM1, also named hPB1 BAF180 and Polybromo-1D, acts as a negative regulator of cell proliferation. PBRM1 is the second major mutated clear cell RCC cancer gene after VHL. PBRM1 loss is associated with low grade features.