PBX1 Monoclonal antibody, PBS Only (Detector)

PBX1 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 67013-1-PBS
Clone No.3C5E2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Homeobox protein PBX1, Homeobox protein PRL, pre B cell leukemia homeobox 1, Pre-B-cell leukemia transcription factor 1, PRL

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67013-1-PBS targets PBX1 as part of a matched antibody pair:

MP50420-1: 67013-2-PBS capture and 67013-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12535

Product name: Recombinant human PBX1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-349 aa of BC101578

Sequence: MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMS

Predict reactive species
Full Name pre-B-cell leukemia homeobox 1
Calculated Molecular Weight 430 aa, 47 kDa
GenBank Accession NumberBC101578
Gene Symbol PBX1
Gene ID (NCBI) 5087
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP40424
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PBX1, also named as Pre-B-cell leukemia transcription factor 1, is a 430 amino acid protein, which belongs to the TALE/PBX homeobox family. PBX1 is expressed in all tissues except in cells of the B and T lineage. PBX1 acts as a transcriptional activator of PF4 in complex with MEIS1. PBX1 may have a role in steroidogenesis and, subsequently, sexual development and differentiation. Isoform PBX1b as part of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells is involved in the transcriptional activation of the ELA1 enhancer.

Loading...
||
New chat

Able

正在加载,请稍候...