PBX3 Recombinant monoclonal antibody

• 

  WB analysis using 86595-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86595-3-RR (PBX3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

PBX3 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86595-3-RR

Clone No.251518A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Homeobox protein PBX3, pre B cell leukemia homeobox 3, Pre-B-cell leukemia transcription factor 3

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, fetal human brain tissue, mouse brain tissue, rat brain tissue, mouse lung tissue, rat lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86595-3-RR targets PBX3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3239

  Product name: Recombinant human PBX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-367 aa of BC016977

  Sequence: QLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQSLVKDPKERGSKGSDIQPTSVVSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN

• Full Name: pre-B-cell leukemia homeobox 3
• Calculated Molecular Weight: 434 aa, 47 kDa
• Observed Molecular Weight: 47-50 kDa
• GenBank Accession Number: BC016977
• Gene Symbol: PBX3
• Gene ID (NCBI): 5090
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40426
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PBX3 is a homeodomain-containing transcription factor of the pre-B cell leukemia (PBX) family, members of which have extensive roles in early development and some adult processes. It plays crucial roles in embryonic development, organogenesis, and cell differentiation by regulating the expression of downstream target genes. Beyond its physiological functions, PBX3 is increasingly recognized for its significant involvement in oncogenesis. It is frequently overexpressed in various malignancies, including leukemias and solid tumors, where it promotes cell proliferation, inhibits apoptosis, enhances invasion and metastasis, and contributes to chemotherapy resistance.