PCARE Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83364-4-RR (same clone as 83364-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83364-4-RR (PCARE antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83364-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse eye using 83364-4-RR (same clone as 83364-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 83364-4-RR (PCARE antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83364-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse eye using 83364-4-RR (same clone as 83364-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 83364-4-RR (PCARE antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83364-4-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse eye using 83364-4-RR (same clone as 83364-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using PCARE antibody (83364-4-RR, Clone: 240352F6 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83364-4-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse eye using 83364-4-RR (same clone as 83364-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using PCARE antibody (83364-4-RR, Clone: 240352F6 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83364-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83364-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83364-4-RR against Human PCARE were performed. The affinity constant is 3.06 nM.

PCARE Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 83364-4-PBS

Clone No.240352F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

C2orf71, 240352F6

---

Product Information

83364-4-PBS targets PCARE in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34774

  Product name: Recombinant human PCARE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 10-150 aa of NM_001029883

  Sequence: LVNSVAKSGIQFLKKPKAIRPGCQGGSERGSIPLLVKNSTCYDAGEGLAEEQPSPRRNQTTAKGLCQLMGDPASGKRKDMEGLIPGTKTSSSQLNKSQSHMAKDIPFKTQGSHGSQGADFSGDESEESSTQDTSKWKRTAK

• Full Name: chromosome 2 open reading frame 71
• Calculated Molecular Weight: 140 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: NM_001029883
• Gene Symbol: PCARE
• Gene ID (NCBI): 388939
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: A6NGG8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C2orf71/PCARE (photoreceptor cilium actin regulator) is a retina-specific protein consisting of 1289 amino acids with a predicted molecular weight of 140 kDa. PCARE is predicted to be myristoylated and palmitoylated at its N terminus and plays an important role in delivering actin-associated components to the base of the photoreceptor OSs to regulate the initial development of OS disks (PMID: 32312818, 35253837).