PCDH19 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PCDH19 Polyclonal antibody (29965-1-AP)

• 

  WB analysis using 29965-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29965-1-AP (PCDH19 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PCDH19 Polyclonal Antibody for WB, ELISA

Cat No. 29965-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

EFMR, EIEE9

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29965-1-AP targets PCDH19 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32302

  Product name: Recombinant human PCDH19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 850-1040 aa of NM_001105243.1

  Sequence: HHSFNSQGPQQPDLIINGVPLPETENYSFDSNYVNSRAHLIKSSSTFKDLEGNSLKDSGHEESDQTDSEHDVQRSLYCDTAVNDVLNTSVTSMGSQMPDHDQNEGFHCREECRILGHSDRCWMPRNPMPIRSKSPEHVRNIIALSIEATAADVEAYDDCGPTKRTFATFGKDVSDHPAEERPTLKGKRTVD*

• Full Name: protocadherin 19
• Calculated Molecular Weight: 126 kDa
• Observed Molecular Weight: 126 kDa
• GenBank Accession Number: NM_001105243.1
• Gene Symbol: PCDH19
• Gene ID (NCBI): 57526
• RRID: AB_3742323
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAB3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PCDH19 is a transmembrane protein and member of the protocadherin family. It is encoded by the X-chromosome and more than 200 mutations have been linked to the neurodevelopmental PCDH-clustering epilepsy (PCDH19-CE) syndrome. PCDH19 is a member of the non-clustered δ2-type protocadherins, has 6 cadherin repeats in the extracellular part, and a cytoplasmic tail containing two conserved domains (CM1 and CM2) (PMID: 36389226).