Use Able AI chat for product recommendations

PCDH9 Polyclonal antibody

PCDH9 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 25090-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Protocadherin-9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman gliomas tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25090-1-AP targets PCDH9 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18696

Product name: Recombinant human PCDH9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1146-1237 aa of BC136626

Sequence: PGLGPYQHPKSPLSTFAPQKEWVKKDKLVNGHTLTRAWKEDSNRNQFNDRKQYGSNEGHFNNGSHMTDIPLANLKSYKQAGGATESPKEHQL

Predict reactive species
Full Name protocadherin 9
Calculated Molecular Weight 1237 aa, 136 kDa
Observed Molecular Weight 150-180 kDa
GenBank Accession NumberBC136626
Gene Symbol PCDH9
Gene ID (NCBI) 5101
RRIDAB_2879891
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HC56
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protocadherin-9 (PCDH9) is a member of the protocadherin family that belongs to the cadherin superfamily. Protocadherins are calcium-dependent adhesion proteins and have been implicated in neural cell-cell interactions. They are abundantly expressed in the central nervous system during embryonic development and in adulthood (PMID: 24214103). PCDH9 is a single-pass type I membrane protein that contains seven cadherin motifs in its extracellular domain. It might be involved in the formation of specific neural circuits during neural development (PMID: 22982106).

What is the molecular weight of PCDH9?

The calculated molecular weight of PCDH9 is 136 kDa.

What are the isoforms of PCDH9?

Alternatively spliced transcript variants encoding distinct isoforms have been identified for the PCDH9 gene; a short transcript, a standard transcript, a transcript with additional exon 2, and another transcript with variant exon 3 (PMID: 15095963).

What is PCDH9's involvement in neural development?

The family of protocadherins is essential for neural development as mutations in these proteins give rise to neurodevelopmental disorders such as schizophrenia and epilepsy. However, the exact mechanisms of loss of function and the role of PCDH9 remain to be fully characterized (PMID: 22982106).


Protocols

Product Specific Protocols
IHC protocol for PCDH9 antibody 25090-1-APDownload protocol
IP protocol for PCDH9 antibody 25090-1-APDownload protocol
WB protocol for PCDH9 antibody 25090-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Neuron

Longitudinal single-cell transcriptional dynamics throughout neurodegeneration in SCA1

Authors - Leon Tejwani
mouseIF

J Neurosci

Disruption of the autism-associated Pcdh9 gene leads to transcriptional alterations, synapse overgrowth, and defective network activity in the CA1

Authors - Federico Miozzo
humanWB

Onco Targets Ther

MiR-200a-3p promoted the malignant behaviors of ovarian cancer cells through regulating PCDH9.

Authors - Can Shi
humanWB

Transl Cancer Res

The lncRNA MIR22HG suppresses prostate cancer cell proliferation, migration, and epithelial-mesenchymal transition via the miR-4428/PCDH9 axis

Authors - Ansu Li
humanIF

Genes (Basel)

Expression of Congenital Anomalies of the Kidney and Urinary Tract (CAKUT) Candidate Genes EDA2R, PCDH9, and TRAF7 in Normal Human Kidney Development and CAKUT

Authors - Jelena Kelam
humanIF

J Pers Med

Epithelial-Mesenchymal Transition Markers in Clear Cell Renal Cell Carcinoma: Expression Patterns and Prognostic Significance.

Authors - Lara Smoljo

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Marlon (Verified Customer) (01-27-2026)

Label really nice RGC axons in wholemount

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Retina
Loading...
||
New chat

Able

正在加载,请稍候...