PCDHA1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PCDHA1 Polyclonal antibody, PBS Only (31671-1-PBS)

• 

  WB analysis using 31671-1-AP (same clone as 31671-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31671-1-AP (PCDHA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31671-1-PBS in a different storage buffer formulation.

PCDHA1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31671-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31671-1-PBS targets PCDHA1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36313

  Product name: Recombinant human PCDHA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 130-310 aa of BC166697

  Sequence: PPVFRGREQIIFIPESRLLNSRFPIEGAADADIGANALLTYTLSPSDYFSLDVEASDELSKSLWLELRKYLDREETPELHLLLTATDGGKPELQGTVELLITVLDVNDNAPLFDQAVYRVHLLETTANGTLVTTLNASDADEGVNGEVVFSFDSGISRDIQEKFKVDSSSGEIRLIDKLDY

• Full Name: protocadherin alpha 1
• Observed Molecular Weight: 102 kDa
• GenBank Accession Number: BC166697
• Gene Symbol: PCDHA1
• Gene ID (NCBI): 56147
• RRID: AB_3670070
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y5I3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Protocadherin alpha-1 (PCDHA1) is a potential calcium-dependent cell adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.