PCDHA6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PCDHA6 Polyclonal antibody (12853-1-AP)

PCDHA6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12853-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

CNR2, CNRN2, CNRS2, CRNR2, PCDH alpha 6, PCDH ALPHA6, PCDHA6, protocadherin alpha 6

• 

  WB analysis of rat brain using 12853-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 12853-1-AP (PCDHA6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12853-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12853-1-AP (PCDHA6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 12853-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 12853-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12853-1-AP (PCDHA6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 12853-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 12853-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat cerebellum using 12853-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat cerebellum using 12853-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 12853-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 12853-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PCDHA6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue
• Positive IHC detected in: mouse cerebellum tissue, human gliomas tissue, rat cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12853-1-AP targets PCDHA6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3493

  Product name: Recombinant human PCDHA6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 711-950 aa of BC036674

  Sequence: LVLTLLLYTALRCSAPPTEGACTADKPTLVCSSAVGSWSYSQQRRQRVCSGEGPPKMDLMAFSPSLSPCPIMMGKAENQDLNEDHDAKPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQEPTNSQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ

• Full Name: protocadherin alpha 6
• Calculated Molecular Weight: 103 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC036674
• Gene Symbol: PCDHA6
• Gene ID (NCBI): 56142
• RRID: AB_10642141
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UN73
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PCDHA6 Polyclonal antibody (Cat# 12853-1-AP) has 1 citation to date. The cited publication appeared in Journal of Neuroinflammation (IF 11.5, 2025), investigating the role of FPR2 antagonism in alleviating social isolation-induced depression and protecting blood-brain barrier integrity in mouse models. The research field is neuroinflammation and neuropsychiatry. The antibody was applied via WB and IF.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	J Neuroinflammation; Role of FPR2 antagonism in alleviating social isolation-induced depression and protecting blood-brain barrier integrity; Authors - Jiayi Zheng