PCDHB12 Polyclonal antibody

• 

  WB analysis of mouse brain using 14020-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14020-1-AP (PCDHB12 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 14020-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14020-1-AP (PCDHB12 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

PCDHB12 Polyclonal Antibody for WB, ELISA

Cat No. 14020-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

PCDH beta 12, PCDH BETA12, PCDHB12, protocadherin beta 12

---

Tested Applications

• Positive WB detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14020-1-AP targets PCDHB12 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5135

  Product name: Recombinant human PCDHB12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 6-350 aa of BC045637

  Sequence: AGTLQIRQVLLFFVLLGMSQAGSETGNFLVMEELQSGSFVGNLAKTLGLEVSELSSRGARVVSNDNKECLQLDTNTGDLLLREMLDREELCGSNEPCVLYFQVLMKNPTQFLQIELQVRDINDHSPVFLEKEMLLEIPENSPVGAVFLLESAKDLDVGINAVKSYTINPNSHFHVKIRVNPDNRKYPELVLDKALDYEERPELSFILTALDGGSPPRSGTALVRVVVVDINDNSPEFEQAFYEVKILENSILGSLVVTVSAWDLDSGTNSELSYTFSHASEDIRKTFEINQKSGDITLTAPLDFEAIESYSIIIQATDGGGLFGKSTVRIQVMDVNDNAPEITVS

• Full Name: protocadherin beta 12
• Calculated Molecular Weight: 87 kDa
• Observed Molecular Weight: 87 kDa
• GenBank Accession Number: BC045637
• Gene Symbol: PCDHB12
• Gene ID (NCBI): 56124
• RRID: AB_2236642
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5F1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.