PCDHGB3 Polyclonal antibody

• 

  IHC staining of mouse kidney using 21204-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 21204-1-AP (PCDHGB3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 21204-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 21204-1-AP (PCDHGB3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 21204-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PCDHGB3 antibody (21204-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

PCDHGB3 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 21204-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

Protocadherin gamma-B3, PCDH-gamma-B3

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21204-1-AP targets PCDHGB3 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15569

  Product name: Recombinant human PCDHGB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-270 aa of BC150172

  Sequence: SEPIRYAIPEELDRGSLVGNLAKDLGFGVGDLPTRNLRVIAEKKFFTVSPENGNLLVSDRIDREEICGKKSTCVLEFEMVAEKPLNFFHVTVLIQDINDNPPTFSQNITELEISELALTGATFALESAQDPDVGVNSLQQYYLSPDPHFSLIQKENLDGSRYPELVLKAPLDREEQPHHHLVLTAVDGGEPSRSCTTQIRVIVADANDNPPVFTQDMYRVNVAENLPAGSSVLKVMAIDMD

• Full Name: protocadherin gamma subfamily B, 3
• Calculated Molecular Weight: 929 aa, 101 kDa
• Observed Molecular Weight: 89 kDa
• GenBank Accession Number: BC150172
• Gene Symbol: PCDHGB3
• Gene ID (NCBI): 56102
• RRID: AB_10858620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5G1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.