PCNA Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 81302-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 81302-2-PBS against Human PCNA was performed. The affinity constant is 0.247 nM.

PCNA Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 81302-2-PBS

Clone No.240306A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

Cyclin, proliferating cell nuclear antigen

---

Product Information

81302-2-PBS targets PCNA in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0277

  Product name: Recombinant human PCNA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 8-256 aa of BC000491

  Sequence: QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE

• Full Name: proliferating cell nuclear antigen
• Calculated Molecular Weight: 29 kDa/31 kDa
• GenBank Accession Number: BC000491
• Gene Symbol: PCNA
• Gene ID (NCBI): 5111
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P12004
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.