PCNA Recombinant monoclonal antibody

PCNA Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, FC (Intra), IP, ELISA

Cat No. 81302-6-RR
Clone No.240306B9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), IP, ELISA

240306B9, Cyclin, proliferating cell nuclear antigen

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, Jurkat cells, A431 cells, MCF-7 cells, NIH/3T3 cells, HSC-T6 cells
Positive IP detected inMCF-7 cells
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse testis tissue
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81302-6-RR targets PCNA in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0277

Product name: Recombinant human PCNA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 8-256 aa of BC000491

Sequence: QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE

Predict reactive species
Full Name proliferating cell nuclear antigen
Calculated Molecular Weight 29 kDa/31 kDa
Observed Molecular Weight36-38 kDa
GenBank Accession NumberBC000491
Gene Symbol PCNA
Gene ID (NCBI) 5111
RRIDAB_3670494
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP12004
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Proliferating Cell Nuclear Antigen, commonly known as PCNA, is a protein that acts as a processivity factor for DNA polymerase δ in eukaryotic cells. This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. PCNA induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. It has to be loaded onto DNA in order to be able to stimulate APEX2. PCNA protein is highly conserved during evolution; the deduced amino acid sequences of rat and human differ by only 4 of 261 amino acids. PCNA has been used as loading control for proliferating cells. The calculated molecular weight of PCNA is 29 kDa, but modified PCNA is 36kDa (PMID: 1358458).

Protocols

Product Specific Protocols
WB protocol for PCNA antibody 81302-6-RRDownload protocol
IHC protocol for PCNA antibody 81302-6-RRDownload protocol
IF protocol for PCNA antibody 81302-6-RRDownload protocol
IP protocol for PCNA antibody 81302-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...