PCNX1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PCNX1 Polyclonal antibody (32431-1-AP)

• 

  WB analysis using 32431-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32431-1-AP (PCNX1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

PCNX1 Polyclonal Antibody for WB, ELISA

Cat No. 32431-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Pecanex-like protein 1, Pecanex homolog protein 1, PCNXL1, PCNX, KIAA0995

---

Tested Applications

• Positive WB detected in: A-253 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32431-1-AP targets PCNX1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37954

  Product name: Recombinant human PCNX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2035-2230 aa of BC140784

  Sequence: VPCRRSSTSQISLRNLPSSIQSRLSMVNQMEPSGQSGLACVQHGLPSSSSSSQSIPACKHHTLVGFLATEGGQSSATDAQPGNTLSPANNSHSRKAEVIYRVQIVDPSQILEGINLSKRKELQWPDEGIRLKAGRNSWKDWSPQEGMEGHVIHRWVPCSRDPGTRSHIDKAVLLVQIDDKYVTVIETGVLELGAEV

• Full Name: pecanex homolog (Drosophila)
• Calculated Molecular Weight: 259 kDa
• Observed Molecular Weight: 240 kDa
• GenBank Accession Number: BC140784
• Gene Symbol: PCNX
• Gene ID (NCBI): 22990
• RRID: AB_3742608
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96RV3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.