PCP4 Polyclonal antibody

• 

  WB analysis using 14705-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14705-1-AP (PCP4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 14705-1-AP

  IP result of anti-PCP4 (IP:14705-1-AP, 4ug; Detection:14705-1-AP 1:1000) with mouse brain tissue lysate 4000 ug.

• 

  IHC staining of mouse cerebellum using 14705-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 14705-1-AP (PCP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 14705-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 14705-1-AP (PCP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cerebellum using 14705-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 14705-1-AP (PCP4 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human cerebellum using 14705-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 14705-1-AP (PCP4 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of mouse brain using 14705-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14705-1-AP (PCP4 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 14705-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14705-1-AP (PCP4 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 14705-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using PCP4 antibody (14705-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse cerebellum using 14705-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using PCP4 antibody (14705-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PCP4 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 14705-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

Brain specific antigen PCP 4, Brain-specific polypeptide PEP-19, Calmodulin regulator protein PCP4, PEP 19, PEP19

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human cerebellum tissue, mouse brain tissue, mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse cerebellum tissue, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 2 publications below
• IF: See 6 publications below

Product Information

14705-1-AP targets PCP4 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6388

  Product name: Recombinant human PCP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-62 aa of BC013791

  Sequence: MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS

• Full Name: Purkinje cell protein 4
• Calculated Molecular Weight: 7 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC013791
• Gene Symbol: PCP4
• Gene ID (NCBI): 5121
• RRID: AB_2878075
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48539
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PCP4, also named as PEP19, belongs to a family of proteins involved in calcium transduction signals and binds calmodulin via an IQ motif, in a calcium independent manner. It is mainly expressed in ectoderm and neuroectoderm comprising neural crest derived cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cancer Cell; Single-Cell Characterization of Malignant Phenotypes and Developmental Trajectories of Adrenal Neuroblastoma.; Authors - Rui Dong
human	IF	Cell Stem Cell; Human brain organoids assemble functionally integrated bilateral optic vesicles.; Authors - Elke Gabriel
human	IF	Nat Commun; Reliability of high-quantity human brain organoids for modeling microcephaly, glioma invasion and drug screening; Authors - Anand Ramani
human	WB	Ann Neurol; PMID: 32167609; Authors - Jimena Monzón-Sandoval
	IHC	Hum Genet; Human organoids for rapid validation of gene variants linked to cochlear malformations; Authors - Mohammad Faraz Zafeer
human	WB	J Pediatr Surg; CAMK2G Promotes Neuronal Differentiation and Inhibits Migration in Neuroblastoma; Authors - Yujie Ma