Tested Applications
Positive WB detected in | mouse brain tissue, rat brain |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human cerebellum tissue, mouse brain tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse cerebellum tissue, mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 4 publications below |
IHC | See 2 publications below |
IF | See 6 publications below |
Product Information
14705-1-AP targets PCP4 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag6388 Product name: Recombinant human PCP4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC013791 Sequence: MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS Predict reactive species |
Full Name | Purkinje cell protein 4 |
Calculated Molecular Weight | 7 kDa |
Observed Molecular Weight | 8 kDa |
GenBank Accession Number | BC013791 |
Gene Symbol | PCP4 |
Gene ID (NCBI) | 5121 |
RRID | AB_2878075 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P48539 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PCP4, also named as PEP19, belongs to a family of proteins involved in calcium transduction signals and binds calmodulin via an IQ motif, in a calcium independent manner. It is mainly expressed in ectoderm and neuroectoderm comprising neural crest derived cells.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PCP4 antibody 14705-1-AP | Download protocol |
IHC protocol for PCP4 antibody 14705-1-AP | Download protocol |
IF protocol for PCP4 antibody 14705-1-AP | Download protocol |
IP protocol for PCP4 antibody 14705-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cancer Cell Single-Cell Characterization of Malignant Phenotypes and Developmental Trajectories of Adrenal Neuroblastoma. | ||
Cell Stem Cell Human brain organoids assemble functionally integrated bilateral optic vesicles. | ||
Nat Commun Reliability of high-quantity human brain organoids for modeling microcephaly, glioma invasion and drug screening | ||
Hum Genet Human organoids for rapid validation of gene variants linked to cochlear malformations | ||
J Pediatr Surg CAMK2G Promotes Neuronal Differentiation and Inhibits Migration in Neuroblastoma |