Tested Applications
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-14705 targets PCP4 in IF-P applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6388 Product name: Recombinant human PCP4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC013791 Sequence: MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS Predict reactive species |
| Full Name | Purkinje cell protein 4 |
| Calculated Molecular Weight | 7 kDa |
| Observed Molecular Weight | 8 kDa |
| GenBank Accession Number | BC013791 |
| Gene Symbol | PCP4 |
| Gene ID (NCBI) | 5121 |
| RRID | AB_2934703 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48539 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PCP4, also named as PEP19, belongs to a family of proteins involved in calcium transduction signals and binds calmodulin via an IQ motif, in a calcium independent manner. It is mainly expressed in ectoderm and neuroectoderm comprising neural crest derived cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 PCP4 antibody CL594-14705 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





