Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human cerebellum tissue, mouse brain tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse cerebellum tissue, mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 2 publications below |
| IF | See 6 publications below |
Product Information
14705-1-AP targets PCP4 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6388 Product name: Recombinant human PCP4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC013791 Sequence: MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS Predict reactive species |
| Full Name | Purkinje cell protein 4 |
| Calculated Molecular Weight | 7 kDa |
| Observed Molecular Weight | 8 kDa |
| GenBank Accession Number | BC013791 |
| Gene Symbol | PCP4 |
| Gene ID (NCBI) | 5121 |
| RRID | AB_2878075 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48539 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PCP4, also named as PEP19, belongs to a family of proteins involved in calcium transduction signals and binds calmodulin via an IQ motif, in a calcium independent manner. It is mainly expressed in ectoderm and neuroectoderm comprising neural crest derived cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PCP4 antibody 14705-1-AP | Download protocol |
| IHC protocol for PCP4 antibody 14705-1-AP | Download protocol |
| IP protocol for PCP4 antibody 14705-1-AP | Download protocol |
| WB protocol for PCP4 antibody 14705-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Cell Single-Cell Characterization of Malignant Phenotypes and Developmental Trajectories of Adrenal Neuroblastoma. | ||
Cell Stem Cell Human brain organoids assemble functionally integrated bilateral optic vesicles. | ||
Nat Commun Reliability of high-quantity human brain organoids for modeling microcephaly, glioma invasion and drug screening | ||
Hum Genet Human organoids for rapid validation of gene variants linked to cochlear malformations | ||
J Pediatr Surg CAMK2G Promotes Neuronal Differentiation and Inhibits Migration in Neuroblastoma |





















