Home
Products
Primary Antibodies
PCP4L1 Polyclonal antibody, PBS Only (25933-1-PBS)

Filter: AllWBIHC

WB analysis of mouse brain using 25933-1-AP (same clone as 25933-1-PBS)
mouse brain tissue were subjected to SDS PAGE followed by western blot with 25933-1-AP (PCP4L1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25933-1-PBS in a different storage buffer formulation.
WB analysis of mouse brain using 25933-1-AP (same clone as 25933-1-PBS)
mouse brain tissue were subjected to SDS PAGE followed by western blot with 25933-1-AP (PCP4L1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25933-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 25933-1-AP (same clone as 25933-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25933-1-AP (PCP4L1 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25933-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 25933-1-AP (same clone as 25933-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25933-1-AP (PCP4L1 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25933-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

PCP4L1 Polyclonal antibody, PBS Only

Name: PCP4L1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 25933-1-PBS

PCP4L1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25933-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

25933-1-PBS targets PCP4L1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag23061 Product name: Recombinant human PCP4L1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC028905 Sequence: MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS Predict reactive species
Full Name	Purkinje cell protein 4 like 1
Calculated Molecular Weight	68 aa, 7 kDa
Observed Molecular Weight	8-15 kDa
GenBank Accession Number	BC028905
Gene Symbol	PCP4L1
Gene ID (NCBI)	654790
RRID	AB_2880301
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	A6NKN8
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

PCP4L1 (Purkinje cell protein 4-like 1) is a small neuronal IQ motif protein closely related to the calmodulin-binding protein Pcp4/PEP-19 (PMID: 22458599).