Home
Products
Primary Antibodies
PCSK5 Polyclonal antibody, PBS Only (16470-1-PBS)

Filter: AllIHC

IHC staining of human kidney using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16470-1-AP (PCSK5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16470-1-AP (PCSK5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16470-1-AP (PCSK5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16470-1-AP (PCSK5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 16470-1-AP (PC6 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 16470-1-AP (PC6 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin using 16470-1-AP (PC6 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin using 16470-1-AP (PC6 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart using 16470-1-AP (PC6 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart using 16470-1-AP (PC6 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 16470-1-AP (PC6 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 16470-1-AP (PC6 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.
IHC staining of human spleen using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded human spleen using 16470-1-AP (PC6 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.
IHC staining of human spleen using 16470-1-AP (same clone as 16470-1-PBS)
Immunohistochemical analysis of paraffin-embedded human spleen using 16470-1-AP (PC6 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 16470-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

PCSK5 Polyclonal antibody, PBS Only

Name: PCSK5 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 16470-1-PBS

PCSK5 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 16470-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

16470-1-PBS targets PCSK5 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9552 Product name: Recombinant human PC5 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 32-351 aa of BC012064 Sequence: TRVYTNHWAVKIAGGFPEANRIASKYGFINIGQIGALKDYYHFYHSRTIKRSVISSRGTHSFISMEPKVEWIQQQVVKKRTKRDYDFSRAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEEC Predict reactive species
Full Name	proprotein convertase subtilisin/kexin type 5
Calculated Molecular Weight	102 kDa, 207 kDa
Observed Molecular Weight	210 kDa
GenBank Accession Number	BC012064
Gene Symbol	PCSK5
Gene ID (NCBI)	5125
RRID	AB_2283381
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q92824
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

PC5 ,a mammalian kex2-like processing endoprotease, mediates posttranslational endoproteolytic processing for several integrin alpha subunits.It has been identified in rat and mouse endocrine and neuroendocrine tissues,and is encoded by multiple mRNAs that generate two splice variant isoforms referred to as PC5A (102KDa) and PC5B (207KDa) .PC5A is smaller than PC5B and it can be processed into two forms (117 kDa and 65 kDa) in neuronal cells(PMID:11457520).