PCSK7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PCSK7 Polyclonal antibody, PBS Only (12044-1-PBS)

• 

  WB analysis using 12044-1-AP (same clone as 12044-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12044-1-AP (PCSK7 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12044-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 12044-1-AP (same clone as 12044-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 12044-1-AP (PCSK7 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12044-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 12044-1-AP (same clone as 12044-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 12044-1-AP (PCSK7 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12044-1-PBS in a different storage buffer formulation.

PCSK7 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12044-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

SPC7, PC8, PC7, LPC, hPC8

---

Product Information

12044-1-PBS targets PCSK7 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2674

  Product name: Recombinant human PCSK7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 39-381 aa of BC010696

  Sequence: AGTGGPDGQGTGGPSWAVHLESLEGDGEEETLEQQADALAQAAGLVNAGRIGELQGHYLFVQPAGHRPALEVEAIRQQVEAVLAGHEAVRWHSEQRLLRRAKRSVHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRGVTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENGNHHGTRCAGEIAAVPNNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGPHQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRMPFYAEECASMLAVTFSGGDKM

• Full Name: proprotein convertase subtilisin/kexin type 7
• Calculated Molecular Weight: 785 aa, 86 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC010696
• Gene Symbol: PCSK7
• Gene ID (NCBI): 9159
• RRID: AB_2877820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16549
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PCSK7(Proprotein convertase subtilisin/kexin type 7) is also named as LPC, PC7, PC8, SPC7 and belongs to the peptidase S8 family. It has ubiquitous endoprotease activity within constitutive secretory pathways and capable of cleavage at the RXXX[KR]R consensus motif. The full length protein has 4 glycosylation sites and it can be N-glycosylated.