PCYOX1L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PCYOX1L Polyclonal antibody, PBS Only (30485-1-PBS)

• 

  WB analysis using 30485-1-AP (same clone as 30485-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30485-1-AP (PCYOX1L antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30485-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30485-1-AP (same clone as 30485-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30485-1-AP (PCYOX1L antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30485-1-PBS in a different storage buffer formulation.

PCYOX1L Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30485-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

30485-1-PBS targets PCYOX1L in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33077

  Product name: Recombinant human PCYOX1L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 305-418 aa of BC000014

  Sequence: ASFRRKQPQEAAVWRVQSPKPLFRTQLKTLFRSYYSVQTAEWQAHPLYGSRPTLPRFALHDQLFYLNALEWAASSVEVMAVAAKNVALLAYNRWYQDLDKIDQKDLMHKVKTEL

• Full Name: prenylcysteine oxidase 1 like
• Calculated Molecular Weight: 494 aa, 55 kDa
• Observed Molecular Weight: 55-57 kDa
• GenBank Accession Number: BC000014
• Gene Symbol: PCYOX1L
• Gene ID (NCBI): 78991
• RRID: AB_3086333
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NBM8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.