PCYT2 Polyclonal antibody

• 

  WB analysis of human liver using 14827-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 14827-1-AP (PCYT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 14827-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14827-1-AP (PCYT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 14827-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14827-1-AP (PCYT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 14827-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PCYT2 antibody (14827-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• Featured Product
• KD/KO Validated

PCYT2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 14827-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Ethanolamine-phosphate cytidylyltransferase, Ethanolamine phosphate cytidylyltransferase, EC:2.7.7.14

---

Tested Applications

• Positive WB detected in: human liver tissue, HepG2 cells, MCF-7 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

14827-1-AP targets PCYT2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6616

  Product name: Recombinant human PCYT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-389 aa of BC000351

  Sequence: MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF

• Full Name: phosphate cytidylyltransferase 2, ethanolamine
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC000351
• Gene Symbol: PCYT2
• Gene ID (NCBI): 5833
• RRID: AB_2159298
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99447
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ethanolamine-phosphate cytidylyltransferase (PCYT2) catalyzes the second step in the synthesis of phosphatidylethanolamine (PE) from ethanolamine via the CDP-ethanolamine pathway (PMID:9083101, PMID:31637422). Phosphatidylethanolamine is a dominant inner-leaflet phospholipid in cell membranes, where it plays a role in membrane function by structurally stabilizing membrane-anchored proteins, and participates in important cellular processes such as cell division, cell fusion, blood coagulation, and apoptosis (PMID:9083101).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; Metabolic control of TFH cells and humoral immunity by phosphatidylethanolamine.; Authors - Guotong Fu ; KO Validated
human	IHC	Int J Mol Sci; Cancer Malignancy Is Correlated with Upregulation of PCYT2-Mediated Glycerol Phosphate Modification of α-Dystroglycan.; Authors - Fumiko Umezawa
human,mouse	IF,WB	Int J Biol Macromol; p75NTR enhances cognitive dysfunction in a mouse Alzheimer's disease model by inhibiting microRNA-210-3p-mediated PCYT2 through activation of NF-κB; Authors - Zhongliang Wei ; KD Validated
human	WB	Evid Based Complement Alternat Med; Metabolomic Study on Nude Mice Models of Gastric Cancer Treated with Modified Si Jun Zi Tang via HILIC UHPLC-Q-TOF/MS Analysis.; Authors - Shanshan Nie