• Featured Product
  • KD/KO Validated

PD-L1/CD274 Monoclonal antibody

The PD-L1 / CD274 monoclonal antibody (66248-1-Ig), also known as PD-L1 antibody, CD274 antibody, or B7-H1 antibody, is validated for WB, IHC, IF/ICC, IF-P, ELISA in human, mouse, rat, pig samples. The 66248-1-Ig has 462 publication citations.
Cat No. 66248-1-Ig
Clone No.2B11D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, ELISA

CD274, PD-L1, 2B11D11, B7 H1, B7-H1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, human placenta tissue, pig lung tissue, human skeletal muscle tissue, HepG2 cells, THP-1 cells, RAW 264.7 cells, A549 cells, K-562 cells, HSC-T6 cells
Positive IHC detected inhuman tonsillitis tissue, human heart tissue, human lung cancer tissue, human placenta tissue, mouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman placenta tissue, mouse thymus tissue
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
Immunofluorescence (IF)-PIF-P : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66248-1-Ig targets PD-L1/CD274 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12443

Product name: Recombinant human PD-L1/CD274 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 25-241 aa of BC074984

Sequence: KDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHL

Predict reactive species
Full Name CD274 molecule
Calculated Molecular Weight 290 aa, 33 kDa
Observed Molecular Weight 45-50 kDa, 33 kDa
GenBank Accession NumberBC074984
Gene Symbol PD-L1
Gene ID (NCBI) 29126
RRIDAB_2756526
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NZQ7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PD-L1, also known as CD274 or B7H1, stands for programmed cell death ligand 1. It is a type I transmembrane protein that is thought to repress immune responses by binding to its receptor (PD1), thus inhibiting T-cell activation, proliferation, and cytokine production. It contains V-like and C-like immunoglobulin domains. PD-L1 expression is regulated by various cytokines, such as TNF-α or LPS (ISSN: 1848-7718). Increased expression of this protein in certain types of cancers, e.g., renal cell carcinoma or colon cancer, correlates with poor prognosis. 

What is the molecular weight of PD-L1? 

Depending on the isoform, the calculated molecular weight of the protein varies between 20 and 33 kDa (176-290 aa). 

What are the isoforms of PD-L1? 

According to NCBI, three different isoforms have been identified. There are significant differences in the untranslated and protein coding regions. 

What is the subcellular localization and tissue specificity of PD-L1? 

It is predicted to localize in the plasma membrane of various cell types, with a particularly high expression in placental trophoblast and subsets of immune cells. High levels of PD-L1 protein have also been detected in lung and colon tissues. 

What is the function of PD-L1 in immune responses? 

PD-L1 is critical for the induction and maintenance of immune self-tolerance during infection or inflammation in normal tissues. The interaction of PD-L1 and its receptors is responsible for preventing auto-immune phenotypes and balancing the overall immune response in situations such as pregnancy or tissue allografts. The interaction between PD-L1 and PD-1 or B7.1 starts an inhibitory signaling cascade, which results in the decreased proliferation of antigen-specific T-cells and increased survival of regulatory T-cells (PMID: 15240681). 

How can PD-L1's implication in cancer be used as a drug target? 

In certain tumors, high expression of PD-L1 serves as a stop-sign to inhibit the recognition of cancer cells by T-cells (PMID: 23087408). The interaction between PD-L1 and its receptors (PD1 and B7.1) is a mechanism for the tumor to evade the host immune response (PMID: 29357948). Several mAbs have been developed to target that interaction and thus prevent the inactivation of cytotoxic T-cells by the tumor (PMIDs: 23890059, 18173375).


Protocols

Product Specific Protocols
IF protocol for PD-L1/CD274 antibody 66248-1-IgDownload protocol
IHC protocol for PD-L1/CD274 antibody 66248-1-IgDownload protocol
WB protocol for PD-L1/CD274 antibody 66248-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cell Res

Targeting ATAD3A-PINK1-mitophagy axis overcomes chemoimmunotherapy resistance by redirecting PD-L1 to mitochondria

Authors - Xiao-Qing Xie
humanWB

Cell

Developing Covalent Protein Drugs via Proximity-Enabled Reactive Therapeutics.

Authors - Qingke Li
mouseWB,IF

Adv Mater

A Bifunctional Lysosome-Targeting Chimera Nanoplatform for Tumor-Selective Protein Degradation and Enhanced Cancer Immunotherapy

Authors - Yumeng Xing
mouseWB,IP,IF

Cell Metab

Dual impacts of serine/glycine-free diet in enhancing antitumor immunity and promoting evasion via PD-L1 lactylation

Authors - Huan Tong
humanWB,IHC,IF

Cancer Cell

ADORA1 Inhibition Promotes Tumor Immune Evasion by Regulating the ATF3-PD-L1 Axis.

Authors - Hong Liu
mouse,humanIHC

Cell Metab

NAD+ Metabolism Maintains Inducible PD-L1 Expression to Drive Tumor Immune Evasion.

Authors - Hongwei Lv

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

JIN-FENG (Verified Customer) (10-08-2025)

It works well in the PD-L1 overexpression cells. In terms of endogenous PD-L1 detection. There are a couple of non-specific bands around the target site.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: cell line
PD-L1/CD274 Antibody Western Blot validation (1:1000 dilution) in cell line (Cat no:66248-1-Ig)
FH

Margarita (Verified Customer) (11-20-2024)

Secondary antibody: AF 488

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: PC3 cells
PD-L1/CD274 Antibody Immunofluorescence validation (1:200 dilution) in PC3 cells (Cat no:66248-1-Ig)
FH

hala (Verified Customer) (01-27-2023)

there is 2 bands one at the specific size and the other one is higher

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/4000
  • Cell Tissue Type: hepG2
PD-L1/CD274 Antibody Western Blot validation (1/4000 dilution) in hepG2 (Cat no:66248-1-Ig)
FH

Emma (Verified Customer) (11-29-2021)

Used for IF on FFPE prostate tissue at 1:50 with Tris-EDTA antigen retrieval (pH 9.0).

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: Prostate
PD-L1/CD274 Antibody Immunofluorescence validation (1:50 dilution) in Prostate (Cat no:66248-1-Ig)
FH

Marina (Verified Customer) (06-14-2021)

HCC1937 breast cancer cells were fixed with 4% PFA, permeabilized and stained overnight at 4ºC with anti-PD-L1 Ig diluted 1:300. Nuclei were stained with DAPI.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: Immortalized human breast cancer cells
PD-L1/CD274 Antibody Immunofluorescence validation (1:300 dilution) in Immortalized human breast cancer cells (Cat no:66248-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...