PDAP1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PDAP1 Recombinant monoclonal antibody (87870-1-RR)

• 

  WB analysis using 87870-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87870-1-RR (PDAP1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87870-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87870-1-RR against Human PDAP1 were performed. The affinity constant is 3.55 nM.

PDAP1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87870-1-RR

Clone No.253363E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

28 kDa heat- and acid-stable phosphoprotein, HASPP28, PDGF associated protein, PDGFA associated protein 1, PDGFA-associated protein 1

---

Tested Applications

• Positive WB detected in: HeLa cells, MDA-MB-468 cells, MRC-5 cells, HuH-7 cells, PANC-1 cells, MCF-7 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87870-1-RR targets PDAP1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7155

  Product name: Recombinant human PDAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC000684

  Sequence: MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK

• Full Name: PDGFA associated protein 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC000684
• Gene Symbol: PDAP1
• Gene ID (NCBI): 11333
• RRID: AB_3745798
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13442
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDAP1 (PDGFA-associated protein 1), also known as PAP, PAP1, or HASPP28 (28 kDa heat- and acid-stable phosphoprotein), is a protein-coding gene located on human chromosome 7q22.1 . The gene consists of 6 exons and encodes a 28 kDa phosphoprotein that is highly conserved across vertebrate species.