PDCD11 Polyclonal antibody

• 

  WB analysis using 31405-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31405-1-AP (PDCD11 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

PDCD11 Polyclonal Antibody for WB, ELISA

Cat No. 31405-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

programmed cell death 11, NFBP, NF kappa B binding protein, KIAA0185, ALG4

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cell

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31405-1-AP targets PDCD11 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35402

  Product name: Recombinant human PDCD11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1290-1480 aa of BC049838

  Sequence: DNVLTLSLRSSRTNPETKSKVEDPEINSIQDIKEGQLLRGYVGSIQPHGVFFRLGPSVVGLARYSHVSQHSPSKKALYNKHLPEGKLLTARVLRLNHQKNLVELSFLPGDTGKPDVLSASLEGQLTKQEERKTEAEERDQKGEKKNQKRNEKKNQKGQEEVEMPSKEKQQPQKPQAQKRGGRECRESGSEQ

• Full Name: programmed cell death 11
• Observed Molecular Weight: 209 kDa
• GenBank Accession Number: BC049838
• Gene Symbol: PDCD11
• Gene ID (NCBI): 22984
• RRID: AB_3669967
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q14690
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDCD11, also known as ALG-4, RRP5, or NFBP, possesses a series of S1 RNA-binding domains in the N-terminus with approximately 1,400 amino acids, followed by a tetratricopeptide repeat (TPR) domain in the C-terminus. Through S1 N-terminal domains, PDCD11 interacts with pre-rRNA to coordinate rRNA processing and assembly in the nucleolus. It also binds to Exonuclease-1 and upregulates Fas to induce cell apoptosis. Recently, PDCD11 was proved to interact with NF-κB subunits to suppress the expression of inflammatory cytokines and activate the TGFβ1 pathway, thereby modulating microglia differentiation during zebrafish development.(PMID: 38062028)